GSTP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GSTP1 full-length ORF ( AAH10915, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.84
Interspecies Antigen Sequence
Rat (85)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GSTP1
Entrez GeneID
2950GeneBank Accession#
BC010915Protein Accession#
AAH10915Gene Name
GSTP1
Gene Alias
DFN7, FAEES3, GST3, PI
Gene Description
glutathione S-transferase pi 1
Omim ID
134660Gene Ontology
HyperlinkGene Summary
Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq
Other Designations
OTTHUMP00000174659|deafness, X-linked 7|fatty acid ethyl ester synthase III|glutathione transferase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Single dose GSTP1 prevents infarction-induced heart failure.
Andrukhova O, Salama M, Krssak M, Wiedemann D, El-Housseiny L, Hacker M, Gildehaus FJ, Andrukhov O, Mirzaei S, Kocher A, Zuckermann A, Aharinejad S.
Journal of Cardiac Failure 2014 Feb; 20(2):135.
Application:Incubated, Recombinant protein.
-
Improvement of protein immobilization for the elaboration of tumor-associated antigen microarrays: application to the sensitive and specific detection of tumor markers from breast cancer sera.
Yang Z, Chevolot Y, Géhin T, Solassol J, Mange A, Souteyrand E, Laurenceau E.
Biosensors & Bioelectronics 2013 Feb; 40(1):385.
Application:Array, Recombinant protein.
-
Single dose GSTP1 prevents infarction-induced heart failure.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com