Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSTP1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002950-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GSTP1 full-length ORF ( AAH10915, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002950-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • 1.
  • Single dose GSTP1 prevents infarction-induced heart failure.
    Andrukhova O, Salama M, Krssak M, Wiedemann D, El-Housseiny L, Hacker M, Gildehaus FJ, Andrukhov O, Mirzaei S, Kocher A, Zuckermann A, Aharinejad SJ Card Fail. 2014 Jan 9. pii: S1071-9164(13)01262-1. doi: 10.1016/j.cardfail.2013.11.012.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2950
  • Gene Name:
  • GSTP1
  • Gene Alias:
  • DFN7,FAEES3,GST3,PI
  • Gene Description:
  • glutathione S-transferase pi 1
  • Gene Summary:
  • Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000174659,deafness, X-linked 7,fatty acid ethyl ester synthase III,glutathione transferase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook