GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTM5 protein.
Immunogen
GSTM5 (NP_000842.2, 1 a.a. ~ 218 a.a) full-length human protein.
Sequence
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTM5 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTM5 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of GSTM5 expression in transfected 293T cell line (H00002949-T01) by GSTM5 MaxPab polyclonal antibody.
Lane 1: GSTM5 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GSTM5
Entrez GeneID
2949GeneBank Accession#
NM_000851.2Protein Accession#
NP_000842.2Gene Name
GSTM5
Gene Alias
GSTM5-5, GTM5
Gene Description
glutathione S-transferase mu 5
Omim ID
138385Gene Ontology
HyperlinkGene Summary
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. [provided by RefSeq
Other Designations
GST class-mu 5|OTTHUMP00000013359|S-(hydroxyalkyl)glutathione lyase M5|glutathione S-alkyltransferase M5|glutathione S-aralkyltransferase M5|glutathione S-aryltransferase M5|glutathione S-transferase M5
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Anti-Cancer Effects and Tumor Marker Role of Glutathione S-Transferase Mu 5 in Human Bladder Cancer.
Yeong-Chin Jou, Shou-Chieh Wang, Yuan-Chang Dia, Shou-Tsung Wang, Min-Hua Yu, Hsin-Yi Yang, Lei-Chin Chen, Cheng-Huang Shen, Yi-Wen Liu.
International Journal of Molecular Sciences 2021 Mar; 22(6):3056.
Application:WB-Ce, WB-Tr, Human, 5637, RT4 cells.
-
Allelic variants of glutathione S-transferase P1-1 differentially mediate the peroxidase function of peroxiredoxin VI and alter membrane lipid peroxidation.
Manevich Y, Hutchens S, Tew KD, Townsend DM.
Free Radical Biology & Medicine 2013 Jan; 54:62.
Application:WB-Tr, Human, MCF-7 cells.
-
Anti-Cancer Effects and Tumor Marker Role of Glutathione S-Transferase Mu 5 in Human Bladder Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com