GSTM4 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTM4 protein.
Immunogen
GSTM4 (NP_000841.1, 1 a.a. ~ 218 a.a) full-length human protein.
Sequence
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTM4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTM4 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of GSTM4 expression in transfected 293T cell line (H00002948-T01) by GSTM4 MaxPab polyclonal antibody.
Lane 1: GSTM4 transfected lysate(25.60 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of GSTM4 transfected lysate using anti-GSTM4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTM4 purified MaxPab mouse polyclonal antibody (B01P) (H00002948-B01P). -
Gene Info — GSTM4
Entrez GeneID
2948GeneBank Accession#
NM_000850.3Protein Accession#
NP_000841.1Gene Name
GSTM4
Gene Alias
GSTM4-4, GTM4, MGC131945, MGC9247
Gene Description
glutathione S-transferase mu 4
Omim ID
138333Gene Ontology
HyperlinkGene Summary
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified. [provided by RefSeq
Other Designations
GST class-mu 4|GTS-Mu2|OTTHUMP00000013356|OTTHUMP00000013358|S-(hydroxyalkyl)glutathione lyase M4|glutathione S-alkyltransferase M4|glutathione S-aralkyltransferase M4|glutathione S-aryltransferase M4|glutathione S-transferase M4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com