GSTM2 monoclonal antibody (M03), clone 1E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GSTM2.
Immunogen
GSTM2 (NP_000839, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (78); Rat (79)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSTM2 monoclonal antibody (M03), clone 1E10. Western Blot analysis of GSTM2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSTM2 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GSTM2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GSTM2
Entrez GeneID
2946GeneBank Accession#
NM_000848Protein Accession#
NP_000839Gene Name
GSTM2
Gene Alias
GST4, GSTM, GSTM2-2, GTHMUS, MGC117303
Gene Description
glutathione S-transferase mu 2 (muscle)
Omim ID
138380Gene Ontology
HyperlinkGene Summary
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. [provided by RefSeq
Other Designations
GST class-mu 2|GST, muscle|OTTHUMP00000013351|S-(hydroxyalkyl)glutathione lyase M2|glutathione S-alkyltransferase M2|glutathione S-aralkyltransferase M2|glutathione S-aryltransferase M2|glutathione S-transferase 4|glutathione S-transferase M1|glutathione
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A DNA hypermethylation profile reveals new potential biomarkers for prostate cancer diagnosis and prognosis.
Ashour N, Angulo JC, Andres G, Alelu R, Gonzalez-Corpas A, Toledo MV, Rodriguez-Barbero JM, Lopez JI, Sanchez-Chapado M, Ropero S.
The Prostate 2014 Sep; 74(12):1171.
Application:IHC-P, Human, Normal glands, Prostate cancers.
-
A DNA hypermethylation profile reveals new potential biomarkers for prostate cancer diagnosis and prognosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com