Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSTA4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002941-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GSTA4 partial ORF ( NP_001503, 168 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.79
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002941-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2941
  • Gene Name:
  • GSTA4
  • Gene Alias:
  • DKFZp686D21185,GSTA4-4,GTA4
  • Gene Description:
  • glutathione S-transferase alpha 4
  • Gene Summary:
  • Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq
  • Other Designations:
  • GST class-alpha,OTTHUMP00000016624,OTTHUMP00000016625,S-(hydroxyalkyl)glutathione lyase A4,glutathione S-alkyltransferase A4,glutathione S-aralkyltransferase A4,glutathione S-aryltransferase A4,glutathione S-transferase A4,glutathione transferase A4-4
  • RSS
  • YouTube
  • Linkedin
  • Facebook