Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSTA4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00002941-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GSTA4 protein.
  • Immunogen:
  • GSTA4 (AAH15523, 1 a.a. ~ 222 a.a) full-length human protein.
  • Sequence:
  • MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GSTA4 MaxPab polyclonal antibody. Western Blot analysis of GSTA4 expression in IMR-32.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GSTA4 expression in transfected 293T cell line (H00002941-T01) by GSTA4 MaxPab polyclonal antibody.

    Lane 1: GSTA4 transfected lysate(24.53 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2941
  • Gene Name:
  • GSTA4
  • Gene Alias:
  • DKFZp686D21185,GSTA4-4,GTA4
  • Gene Description:
  • glutathione S-transferase alpha 4
  • Gene Summary:
  • Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq
  • Other Designations:
  • GST class-alpha,OTTHUMP00000016624,OTTHUMP00000016625,S-(hydroxyalkyl)glutathione lyase A4,glutathione S-alkyltransferase A4,glutathione S-aralkyltransferase A4,glutathione S-aryltransferase A4,glutathione S-transferase A4,glutathione transferase A4-4
  • RSS
  • YouTube
  • Linkedin
  • Facebook