GSN monoclonal antibody (M01), clone 3G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GSN monoclonal antibody (M01), clone 3G5 Western Blot analysis of GSN expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of GSN expression in transfected 293T cell line by GSN monoclonal antibody (M01), clone 3G5.
Lane 1: GSN transfected lysate(85.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]
Immunoprecipitation
Immunoprecipitation of GSN transfected lysate using anti-GSN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSN MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSN is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GSN.
Immunogen
GSN (AAH26033, 673 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSN monoclonal antibody (M01), clone 3G5 Western Blot analysis of GSN expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GSN expression in transfected 293T cell line by GSN monoclonal antibody (M01), clone 3G5.
Lane 1: GSN transfected lysate(85.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]Immunoprecipitation
Immunoprecipitation of GSN transfected lysate using anti-GSN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSN MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSN is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GSN
Entrez GeneID
2934GeneBank Accession#
BC026033Protein Accession#
AAH26033Gene Name
GSN
Gene Alias
DKFZp313L0718
Gene Description
gelsolin (amyloidosis, Finnish type)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022011|OTTHUMP00000162202|gelsolin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The effects of plasma gelsolin on human erythroblast maturation for erythrocyte production.
Han SY, Lee EM, Choi HS, Chun BH, Baek EJ.
Stem Cell Research 2018 May; 29:64.
Application：S-ELISA, Human, Supernatants.
-
The effects of plasma gelsolin on human erythroblast maturation for erythrocyte production.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com