Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDIA3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002923-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDIA3 partial ORF ( AAH14433, 396 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002923-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2923
  • Gene Name:
  • PDIA3
  • Gene Alias:
  • ER60,ERp57,ERp60,ERp61,GRP57,GRP58,HsT17083,P58,PI-PLC
  • Gene Description:
  • protein disulfide isomerase family A, member 3
  • Gene Summary:
  • This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. [provided by RefSeq
  • Other Designations:
  • 58 kDa microsomal protein,OTTHUMP00000041709,endoplasmic reticulum P58,glucose regulated protein, 58kDa,phospholipase C-alpha,protein disulfide isomerase-associated 3,protein disulfide-isomerase A3
  • RSS
  • YouTube
  • Linkedin
  • Facebook