GRLF1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GRLF1 full-length ORF ( AAH03514, 1 a.a. - 36 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
29.7
Interspecies Antigen Sequence
Mouse (35); Rat (35)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GRLF1
Entrez GeneID
2909GeneBank Accession#
BC003514Protein Accession#
AAH03514Gene Name
GRLF1
Gene Alias
GRF-1, KIAA1722, MGC10745, P190-A, P190A, p190RhoGAP
Gene Description
glucocorticoid receptor DNA binding factor 1
Omim ID
605277Gene Ontology
HyperlinkGene Summary
The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com