Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NR3C1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002908-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NR3C1 partial ORF ( AAH15610, 51 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002908-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2908
  • Gene Name:
  • NR3C1
  • Gene Alias:
  • GCCR,GCR,GR,GRL
  • Gene Description:
  • nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
  • Gene Summary:
  • The protein encoded by this gene is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined. [provided by RefSeq
  • Other Designations:
  • nuclear receptor subfamily 3, group C, member 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook