Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GRIN2C (Human) Recombinant Protein (P01)

  • Catalog # : H00002905-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GRIN2C full-length ORF ( AAH59384.1, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002905-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2905
  • Gene Name:
  • GRIN2C
  • Gene Alias:
  • NMDAR2C,NR2C
  • Gene Description:
  • glutamate receptor, ionotropic, N-methyl D-aspartate 2C
  • Gene Summary:
  • N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).
  • Other Designations:
  • N-methyl-D-aspartate receptor subunit 2C
  • RSS
  • YouTube
  • Linkedin
  • Facebook