Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GRIN1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002902-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GRIN1 partial ORF ( NP_015566, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002902-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2902
  • Gene Name:
  • GRIN1
  • Gene Alias:
  • NMDA1,NMDAR1,NR1
  • Gene Description:
  • glutamate receptor, ionotropic, N-methyl D-aspartate 1
  • Gene Summary:
  • The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • N-methyl-D-aspartate receptor channel, subunit zeta-1,NMDA receptor 1,OTTHUMP00000022678,glutamate [NMDA] receptor subunit zeta 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook