Product Browser

Last updated: 2017/4/30
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GRIN1 polyclonal antibody (A01)

  • Catalog # : H00002902-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GRIN1.
  • Immunogen:
  • GRIN1 (NP_015566, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002902-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2902
  • Gene Name:
  • GRIN1
  • Gene Alias:
  • NMDA1,NMDAR1,NR1
  • Gene Description:
  • glutamate receptor, ionotropic, N-methyl D-aspartate 1
  • Gene Summary:
  • The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • N-methyl-D-aspartate receptor channel, subunit zeta-1,NMDA receptor 1,OTTHUMP00000022678,glutamate [NMDA] receptor subunit zeta 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook