GRN (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GRN partial ORF ( NP_002078, 494 a.a. - 593 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Rat (62)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GRN
Entrez GeneID
2896GeneBank Accession#
NM_002087Protein Accession#
NP_002078Gene Name
GRN
Gene Alias
GEP, GP88, PCDGF, PEPI, PGRN
Gene Description
granulin
Gene Ontology
HyperlinkGene Summary
Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. [provided by RefSeq
Other Designations
PC cell-derived growth factor|acrogranin|granulin-epithelin|proepithelin|progranulin
-
Interactome
-
Disease
-
Publication Reference
-
The neurotrophic properties of progranulin depend on the granulin E domain but do not require sortilin binding.
De Muynck L, Herdewyn S, Beel S, Scheveneels W, Van Den Bosch L, Robberecht W, Van Damme P.
Neurobiology of Aging 2013 Nov; 34(11):2541.
Application:Func, PI, Rat, Rat neurons, Recombinant protein.
-
Progranulin Does Not Bind Tumor Necrosis Factor (TNF) Receptors and Is Not a Direct Regulator of TNF-Dependent Signaling or Bioactivity in Immune or Neuronal Cells.
Chen X, Chang J, Deng Q, Xu J, Nguyen TA, Martens LH, Cenik B, Taylor G, Hudson KF, Chung J, Yu K, Yu P, Herz J, Farese RV Jr, Kukar T, Tansey MG.
The Journal of Neuroscience 2013 May; 33(21):9202.
Application:Added, Recombinant protein.
-
Progranulin functions as a neurotrophic factor to regulate neurite outgrowth and enhance neuronal survival.
Van Damme P, Van Hoecke A, Lambrechts D, Vanacker P, Bogaert E, van Swieten J, Carmeliet P, Van Den Bosch L, Robberecht W.
Journal of Cellular Biology 2008 Mar; 181(1):37.
Application:Func, Rat, Rat neurons.
-
The neurotrophic properties of progranulin depend on the granulin E domain but do not require sortilin binding.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com