Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAPGEF1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002889-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAPGEF1 partial ORF ( AAH41710, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002889-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2889
  • Gene Name:
  • RAPGEF1
  • Gene Alias:
  • C3G,DKFZp781P1719,GRF2
  • Gene Description:
  • Rap guanine nucleotide exchange factor (GEF) 1
  • Gene Summary:
  • This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000064558,guanine nucleotide-releasing factor 2,guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
  • RSS
  • YouTube
  • Linkedin
  • Facebook