Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAPGEF1 monoclonal antibody (M01), clone 3D10

  • Catalog # : H00002889-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RAPGEF1.
  • Immunogen:
  • RAPGEF1 (AAH41710, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002889-M01
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RAPGEF1 expression in transfected 293T cell line by RAPGEF1 monoclonal antibody (M01), clone 3D10.

    Lane 1: RAPGEF1 transfected lysate(122.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged RAPGEF1 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2889
  • Gene Name:
  • RAPGEF1
  • Gene Alias:
  • C3G,DKFZp781P1719,GRF2
  • Gene Description:
  • Rap guanine nucleotide exchange factor (GEF) 1
  • Gene Summary:
  • This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000064558,guanine nucleotide-releasing factor 2,guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
  • RSS
  • YouTube
  • Linkedin
  • Facebook