RAPGEF1 monoclonal antibody (M01), clone 3D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RAPGEF1 expression in transfected 293T cell line by RAPGEF1 monoclonal antibody (M01), clone 3D10.
Lane 1: RAPGEF1 transfected lysate(122.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAPGEF1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAPGEF1.
Immunogen
RAPGEF1 (AAH41710, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RAPGEF1 expression in transfected 293T cell line by RAPGEF1 monoclonal antibody (M01), clone 3D10.
Lane 1: RAPGEF1 transfected lysate(122.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAPGEF1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — RAPGEF1
Entrez GeneID
2889GeneBank Accession#
BC041710Protein Accession#
AAH41710Gene Name
RAPGEF1
Gene Alias
C3G, DKFZp781P1719, GRF2
Gene Description
Rap guanine nucleotide exchange factor (GEF) 1
Omim ID
600303Gene Ontology
HyperlinkGene Summary
This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000064558|guanine nucleotide-releasing factor 2|guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1.
Nolz JC, Nacusi LP, Segovis CM, Medeiros RB, Mitchell JS, Shimizu Y, Billadeau DD.
Journal of Cellular Biology 2008 Sep; 182(6):1231.
Application：WB-Tr, Human, Jurkat cells, Primary human CD4+ T cells.
-
The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com