GRB10 monoclonal antibody (M01), clone 1A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GRB10 monoclonal antibody (M01), clone 1A7. Western Blot analysis of GRB10 expression in IMR-32.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRB10 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GRB10.
Immunogen
GRB10 (AAH24285, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GRB10 monoclonal antibody (M01), clone 1A7. Western Blot analysis of GRB10 expression in IMR-32.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRB10 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GRB10
Entrez GeneID
2887GeneBank Accession#
BC024285Protein Accession#
AAH24285Gene Name
GRB10
Gene Alias
GRB-IR, Grb-10, IRBP, KIAA0207, MEG1, RSS
Gene Description
growth factor receptor-bound protein 10
Omim ID
601523Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
GRB10 adaptor protein|insulin receptor-binding protein Grb-IR|maternally expressed gene 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com