GPX1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GPX1 full-length ORF ( NP_000572.2, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.1
Interspecies Antigen Sequence
Mouse (85); Rat (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GPX1
Entrez GeneID
2876GeneBank Accession#
NM_000581.2Protein Accession#
NP_000572.2Gene Name
GPX1
Gene Alias
GSHPX1, MGC14399, MGC88245
Gene Description
glutathione peroxidase 1
Omim ID
138320Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
cellular glutathione peroxidase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com