Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPX1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002876-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GPX1 full-length ORF ( NP_000572.2, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2876
  • Gene Name:
  • GPX1
  • Gene Alias:
  • GSHPX1,MGC14399,MGC88245
  • Gene Description:
  • glutathione peroxidase 1
  • Gene Summary:
  • This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • cellular glutathione peroxidase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook