GPS2 monoclonal antibody (M01), clone 3C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 monoclonal antibody (M01), clone 3C4.
Lane 1: GPS2 transfected lysate (Predicted MW: 36.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GPS2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GPS2.
Immunogen
GPS2 (AAH13652, 228 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 monoclonal antibody (M01), clone 3C4.
Lane 1: GPS2 transfected lysate (Predicted MW: 36.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GPS2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — GPS2
Entrez GeneID
2874GeneBank Accession#
BC013652Protein Accession#
AAH13652Gene Name
GPS2
Gene Alias
AMF-1, MGC104294, MGC119287, MGC119288, MGC119289
Gene Description
G protein pathway suppressor 2
Omim ID
601935Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq
Other Designations
OTTHUMP00000128385|OTTHUMP00000163158
-
Interactome
-
Publication Reference
-
Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis.
Sanyal S, Bavner A, Haroniti A, Nilsson LM, Lundasen T, Rehnmark S, Witt MR, Einarsson C, Talianidis I, Gustafsson JA, Treuter E.
PNAS 2007 Sep; 104(40):15665.
Application：WB-Tr, Human, HepG2 cells.
-
Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com