GPS2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GPS2 expression in transfected 293T cell line (H00002874-T03) by GPS2 MaxPab polyclonal antibody.
Lane 1: GPS2 transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GPS2 protein.
Immunogen
GPS2 (NP_004480.1, 1 a.a. ~ 327 a.a) full-length human protein.
Sequence
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GPS2 expression in transfected 293T cell line (H00002874-T03) by GPS2 MaxPab polyclonal antibody.
Lane 1: GPS2 transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GPS2
Entrez GeneID
2874GeneBank Accession#
NM_004489Protein Accession#
NP_004480.1Gene Name
GPS2
Gene Alias
AMF-1, MGC104294, MGC119287, MGC119288, MGC119289
Gene Description
G protein pathway suppressor 2
Omim ID
601935Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq
Other Designations
OTTHUMP00000128385|OTTHUMP00000163158
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com