GRK6 monoclonal antibody (M06), clone 2G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GRK6 monoclonal antibody (M06), clone 2G1 Western Blot analysis of GRK6 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
GRK6 monoclonal antibody (M06), clone 2G1. Western Blot analysis of GRK6 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
GRK6 monoclonal antibody (M06), clone 2G1. Western Blot analysis of GRK6 expression in Raw 264.7(Cat # L024V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRK6 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GRK6.
Immunogen
GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GRK6 monoclonal antibody (M06), clone 2G1 Western Blot analysis of GRK6 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
GRK6 monoclonal antibody (M06), clone 2G1. Western Blot analysis of GRK6 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
GRK6 monoclonal antibody (M06), clone 2G1. Western Blot analysis of GRK6 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRK6 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — GRK6
Entrez GeneID
2870GeneBank Accession#
BC017272Protein Accession#
AAH17272Gene Name
GRK6
Gene Alias
FLJ32135, GPRK6
Gene Description
G protein-coupled receptor kinase 6
Omim ID
600869Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com