Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPR30 (Human) Recombinant Protein (P01)

  • Catalog # : H00002852-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GPR30 full-length ORF ( NP_001496.1, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 68.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002852-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2852
  • Gene Name:
  • GPER
  • Gene Alias:
  • CEPR,CMKRL2,DRY12,FEG-1,GPCR-Br,GPR30,LERGU,LERGU2,LyGPR,MGC99678
  • Gene Description:
  • G protein-coupled estrogen receptor 1
  • Gene Summary:
  • This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq
  • Other Designations:
  • G protein-coupled receptor 30,IL8-related receptor,OTTHUMP00000115502,chemokine receptor-like 2,constitutively expressed peptide-like receptor,flow-induced endothelial G-protein coupled receptor,heptahelix receptor,leucine rich protein in GPR30 3'UTR
  • RSS
  • YouTube
  • Linkedin
  • Facebook