Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPER (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00002852-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GPER full-length ORF (NP_001496.1) recombinant protein without tag.
  • Sequence:
  • MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.2
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 2852
  • Gene Name:
  • GPER
  • Gene Alias:
  • CEPR,CMKRL2,DRY12,FEG-1,GPCR-Br,GPR30,LERGU,LERGU2,LyGPR,MGC99678
  • Gene Description:
  • G protein-coupled estrogen receptor 1
  • Gene Summary:
  • This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq
  • Other Designations:
  • G protein-coupled receptor 30,IL8-related receptor,OTTHUMP00000115502,chemokine receptor-like 2,constitutively expressed peptide-like receptor,flow-induced endothelial G-protein coupled receptor,heptahelix receptor,leucine rich protein in GPR30 3'UTR
  • RSS
  • YouTube
  • Linkedin
  • Facebook