MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MCHR1 MaxPab rabbit polyclonal antibody. Western Blot analysis of MCHR1 expression in IMR-32.
Western Blot (Transfected lysate)
Western Blot analysis of MCHR1 expression in transfected 293T cell line (H00002847-T01) by MCHR1 MaxPab polyclonal antibody.
Lane 1: MCHR1 transfected lysate(46.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MCHR1 protein.
Immunogen
MCHR1 (AAH21146.1, 1 a.a. ~ 422 a.a) full-length human protein.
Sequence
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MCHR1 MaxPab rabbit polyclonal antibody. Western Blot analysis of MCHR1 expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of MCHR1 expression in transfected 293T cell line (H00002847-T01) by MCHR1 MaxPab polyclonal antibody.
Lane 1: MCHR1 transfected lysate(46.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MCHR1
Entrez GeneID
2847GeneBank Accession#
BC021146Protein Accession#
AAH21146.1Gene Name
MCHR1
Gene Alias
GPR24, MCH1R, MGC32129, SLC1
Gene Description
melanin-concentrating hormone receptor 1
Omim ID
601751Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq
Other Designations
G protein-coupled receptor 24|G-protein coupled receptor 24
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com