Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
pathway

PRLHR (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00002834-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRLHR full-length ORF (NP_004239.1) recombinant protein without tag.
  • Sequence:
  • MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.1
  • Form:
  • Liquid
  • Purification:
  • None
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 2834
  • Gene Name:
  • PRLHR
  • Gene Alias:
  • GPR10,GR3,MGC126539,MGC126541,PrRPR
  • Gene Description:
  • prolactin releasing hormone receptor
  • Gene Summary:
  • PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH; MIM 602663) that is highly expressed in anterior pituitary (Ozawa et al., 2002 [PubMed 11923475]).[supplied by OMIM
  • Other Designations:
  • G protein-coupled receptor 10,OTTHUMP00000020584,prolactin releasing peptide receptor,prolactin-releasing hormone receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook