CXCR3 (Human) Recombinant Protein (Q02)

Catalog # H00002833-Q02

Size

Price

Stock

Quantity

Size:25 ug
Price: USD $ 510.00
Stock:
order now, ship next day
abnova-minus
abnova-plus
Size:10 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
QC Test

  • Specification

    Product Description

    Human CXCR3 partial ORF ( NP_001495.1, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.

    Sequence

    MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    31.57

    Interspecies Antigen Sequence

    Mouse (70); Rat (70)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — CXCR3

    Entrez GeneID

    2833

    GeneBank Accession#

    NM_001504

    Protein Accession#

    NP_001495.1

    Gene Name

    CXCR3

    Gene Alias

    CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR

    Gene Description

    chemokine (C-X-C motif) receptor 3

    Omim ID

    300574

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed IP10 (interferon-g-inducible 10 kDa protein), Mig (monokine induced by interferon-g) and I-TAC (interferon-inducible T cell a-chemoattractant). IP10, Mig and I-TAC belong to the structural subfamily of CXC chemokines, in which a single amino acid residue separates the first two of four highly conserved Cys residues. Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Inhibition by Bordetella pertussis toxin suggests that heterotrimeric G protein of the Gi-subclass couple to this protein. Signal transduction has not been further analyzed but may include the same enzymes that were identified in the signaling cascade induced by other chemokine receptors. As a consequence of chemokine-induced cellular desensitization (phosphorylation-dependent receptor internalization), cellular responses are typically rapid and short in duration. Cellular responsiveness is restored after dephosphorylation of intracellular receptors and subsequent recycling to the cell surface. This gene is prominently expressed in in vitro cultured effector/memory T cells, and in T cells present in many types of inflamed tissues. In addition, IP10, Mig and I-TAC are commonly produced by local cells in inflammatory lesion, suggesting that this gene and its chemokines participate in the recruitment of inflammatory cells. Therefore, this protein is a target for the development of small molecular weight antagonists, which may be used in the treatment of diverse inflammatory diseases. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    G protein-coupled receptor 9|IP10 receptor|Mig receptor|OTTHUMP00000070257|chemokine (C-X-C) receptor 3

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All