GP1BA monoclonal antibody (M02), clone 1C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GP1BA.
Immunogen
GP1BA (AAH27955, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVPFNRL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of GP1BA transfected lysate using anti-GP1BA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GP1BA MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GP1BA is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GP1BA
Entrez GeneID
2811GeneBank Accession#
BC027955Protein Accession#
AAH27955Gene Name
GP1BA
Gene Alias
BSS, CD42B, CD42b-alpha, GP1B, MGC34595
Gene Description
glycoprotein Ib (platelet), alpha polypeptide
Gene Ontology
HyperlinkGene Summary
Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Several polymorphisms and mutations have been described in this gene, some of which are the cause of Bernard-Soulier syndromes and platelet-type von Willebrand disease. [provided by RefSeq
Other Designations
platelet glycoprotein Ib alpha polypeptide|platelet membrane glycoprotein 1b-alpha subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Inhibition of platelet aggregation and blood coagulation by a P-III class metalloproteinase purified from Naja atra venom.
Qian-Yun Sun, Cai-E Wang, Ya-Nan Li, Juan Bao.
Toxicon 2020 Nov; 187:223.
Application:WB-Ce, Human, Human platelets.
-
Inhibition of platelet aggregation and blood coagulation by a P-III class metalloproteinase purified from Naja atra venom.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com