GOT2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GOT2 partial ORF ( NP_002071, 331 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GOT2
Entrez GeneID
2806GeneBank Accession#
NM_002080Protein Accession#
NP_002071Gene Name
GOT2
Gene Alias
FLJ40994, KAT4, KATIV, mitAAT
Gene Description
glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Omim ID
138150Gene Ontology
HyperlinkGene Summary
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq
Other Designations
aspartate aminotransferase 2|kynurenine aminotransferase IV
-
Interactome
-
Pathway
- Alanine
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Cysteine and methionine metabolism
- Isoquinoline alkaloid biosynthesis
- Metabolic pathways
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com