Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GOLGA2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002801-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GOLGA2 partial ORF (AAH06381.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.94
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002801-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2801
  • Gene Name:
  • GOLGA2
  • Gene Alias:
  • GM130,MGC20672
  • Gene Description:
  • golgi autoantigen, golgin subfamily a, 2
  • Gene Summary:
  • The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • Golgi autoantigen, golgin subfamily a, 2,Golgi matrix protein GM130,OTTHUMP00000022234,SY11 protein,golgin-95
  • RSS
  • YouTube
  • Linkedin
  • Facebook