GOLGA2 monoclonal antibody (M01), clone 2C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GOLGA2 monoclonal antibody (M01), clone 2C6. Western Blot analysis of GOLGA2 expression in human spleen.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GOLGA2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.94 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GOLGA2.
Immunogen
GOLGA2 (AAH06381.1, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.94 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GOLGA2 monoclonal antibody (M01), clone 2C6. Western Blot analysis of GOLGA2 expression in human spleen.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GOLGA2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — GOLGA2
Entrez GeneID
2801GeneBank Accession#
BC006381Protein Accession#
AAH06381.1Gene Name
GOLGA2
Gene Alias
GM130, MGC20672
Gene Description
golgi autoantigen, golgin subfamily a, 2
Omim ID
602580Gene Ontology
HyperlinkGene Summary
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq
Other Designations
Golgi autoantigen, golgin subfamily a, 2|Golgi matrix protein GM130|OTTHUMP00000022234|SY11 protein|golgin-95
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com