Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GNL1 polyclonal antibody (A01)

  • Catalog # : H00002794-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GNL1.
  • Immunogen:
  • GNL1 (NP_005266, 111 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ELLELDIREVYQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002794-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2794
  • Gene Name:
  • GNL1
  • Gene Alias:
  • HSR1
  • Gene Description:
  • guanine nucleotide binding protein-like 1
  • Gene Summary:
  • The GNL1 gene, identified in the human major histocompatibility complex class I region, shows a high degree of similarity with its mouse counterpart. The GNL1 gene is located less than 2 kb centromeric to HLA-E, in the same transcriptional orientation. GNL1 is telomeric to HLA-B and HLA-C. [provided by RefSeq
  • Other Designations:
  • GTP-binding protein,HSR1 GTP-binding protein,OTTHUMP00000029186,guanine nucleotide binding protein-like 1; HSR1 GTP-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook