Product Browser

Last updated: 2017/3/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GNGT2 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00002793-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GNGT2 protein.
  • Immunogen:
  • GNGT2 (AAH08663.1, 1 a.a. ~ 69 a.a) full-length human protein.
  • Sequence:
  • MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GNGT2 expression in transfected 293T cell line (H00002793-T02) by GNGT2 MaxPab polyclonal antibody.

    Lane 1: GNGT2 transfected lysate(7.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2793
  • Gene Name:
  • GNGT2
  • Gene Alias:
  • G-GAMMA-8,G-GAMMA-C,GNG8,GNG9,GNGT8
  • Gene Description:
  • guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
  • Gene Summary:
  • Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene. [provided by RefSeq
  • Other Designations:
  • G protein cone gamma 8 subunit,gamma-T2 subunit,guanine nucleotide binding protein gamma 9,guanine nucleotide binding protein-gamma transducing activity polypeptide 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook