Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GNGT1 purified MaxPab mouse polyclonal antibody (B03P)MaxPab

  • Catalog # : H00002792-B03P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GNGT1 protein.
  • Immunogen:
  • GNGT1 (AAH29367, 1 a.a. ~ 74 a.a) full-length human protein.
  • Sequence:
  • MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GNGT1 expression in transfected 293T cell line (H00002792-T04) by GNGT1 MaxPab polyclonal antibody.

    Lane 1: GNGT1 transfected lysate(8.25 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2792
  • Gene Name:
  • GNGT1
  • Gene Alias:
  • GNG1
  • Gene Description:
  • guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
  • Gene Summary:
  • Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000024526
  • RSS
  • YouTube
  • Linkedin
  • Facebook