Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GNG11 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00002791-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GNG11 protein.
  • Immunogen:
  • GNG11 (AAH09709.1, 1 a.a. ~ 73 a.a) full-length human protein.
  • Sequence:
  • MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GNG11 expression in transfected 293T cell line (H00002791-T01) by GNG11 MaxPab polyclonal antibody.

    Lane 1: GNG11 transfected lysate(8.14 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2791
  • Gene Name:
  • GNG11
  • Gene Alias:
  • GNGT11
  • Gene Description:
  • guanine nucleotide binding protein (G protein), gamma 11
  • Gene Summary:
  • This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq
  • Other Designations:
  • G protein gamma-11 subunit,guanine nucleotide binding protein gamma 11,guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook