Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GNG3 polyclonal antibody (A01)

  • Catalog # : H00002785-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant GNG3.
  • Immunogen:
  • GNG3 (AAH15563, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002785-A01
    Western Blot detection against Immunogen (34.36 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2785
  • Gene Name:
  • GNG3
  • Gene Alias:
  • -
  • Gene Description:
  • guanine nucleotide binding protein (G protein), gamma 3
  • Gene Summary:
  • G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al., 2004 [PubMed 15314181]).
  • Other Designations:
  • NBP gamma-3,guanine nucleotide-binding protein gamma-3 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook