GLUD2 monoclonal antibody (M01), clone 3C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GLUD2 monoclonal antibody (M01), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of GLUD2 expression in transfected 293T cell line by GLUD2 monoclonal antibody (M01), clone 3C2.
Lane 1: GLUD2 transfected lysate(61 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml]
Immunoprecipitation
Immunoprecipitation of GLUD2 transfected lysate using anti-GLUD2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLUD2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GLUD2 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (54.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant GLUD2.
Immunogen
GLUD2 (AAH05111.1, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GLUD2 monoclonal antibody (M01), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of GLUD2 expression in transfected 293T cell line by GLUD2 monoclonal antibody (M01), clone 3C2.
Lane 1: GLUD2 transfected lysate(61 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml]Immunoprecipitation
Immunoprecipitation of GLUD2 transfected lysate using anti-GLUD2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLUD2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GLUD2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — GLUD2
Entrez GeneID
2747GeneBank Accession#
BC005111.1Protein Accession#
AAH05111.1Gene Name
GLUD2
Gene Alias
GDH2, GLUDP1
Gene Description
glutamate dehydrogenase 2
Omim ID
300144Gene Ontology
HyperlinkGene Summary
Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130).[supplied by OMIM
Other Designations
glutamate dehydrogenase pseudogene 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.
Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK.
PLoS Computational Biology 2011 Jun; 7(6):e1002093.
Application：WB-Ce, Human, 143B TK- osteosarcoma cells.
-
Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com