GLRX monoclonal antibody (M02), clone 3C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GLRX monoclonal antibody (M01), clone 3C11 Western Blot analysis of GLRX expression in Jurkat ( Cat # L017V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GLRX on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GLRX is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GLRX.
Immunogen
GLRX (AAH10965, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GLRX monoclonal antibody (M01), clone 3C11 Western Blot analysis of GLRX expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GLRX on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GLRX is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — GLRX
-
Interactome
-
Disease
-
Publication Reference
-
S-glutathionylation of IRF3 regulates IRF3-CBP interaction and activation of the IFN beta pathway.
Efthimios Prinarakis, Eleni Chantzoura, Dimitris Thanos, Giannis Spyrou.
The EMBO Journal 2008 Mar; 27(6):865.
Application：WB-Tr, Human, HEK 293 cells.
-
S-glutathionylation of IRF3 regulates IRF3-CBP interaction and activation of the IFN beta pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com