Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GLO1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00002739-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human GLO1 protein.
  • Immunogen:
  • GLO1 (AAH15934.1, 1 a.a. ~ 184 a.a) full-length human protein.
  • Sequence:
  • MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GLO1 expression in transfected 293T cell line (H00002739-T02) by GLO1 MaxPab polyclonal antibody.

    Lane 1: GLO1 transfected lysate(20.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of GLO1 transfected lysate using anti-GLO1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GLO1 MaxPab rabbit polyclonal antibody (D01) (H00002739-D01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2739
  • Gene Name:
  • GLO1
  • Gene Alias:
  • GLOD1,GLYI
  • Gene Description:
  • glyoxalase I
  • Gene Summary:
  • The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016339,glyoxalase domain containing 1,lactoyl glutathione lyase,lactoylglutathione lyase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook