Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GJA8 polyclonal antibody (A01)

  • Catalog # : H00002703-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GJA8.
  • Immunogen:
  • GJA8 (NP_005258, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002703-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2703
  • Gene Name:
  • GJA8
  • Gene Alias:
  • CAE,CAE1,CX50,CZP1,MP70
  • Gene Description:
  • gap junction protein, alpha 8, 50kDa
  • Other Designations:
  • OTTHUMP00000025757,cell surface glycoprotein,connexin 50,gap junction membrane channel protein alpha-8
  • RSS
  • YouTube
  • Linkedin
  • Facebook