Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GHRHR (Human) Recombinant Protein (Q01)

  • Catalog # : H00002692-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GHRHR partial ORF ( NP_000814, 23 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKII
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002692-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2692
  • Gene Name:
  • GHRHR
  • Gene Alias:
  • GHRFR,GHRHRpsv,GRFR
  • Gene Description:
  • growth hormone releasing hormone receptor
  • Gene Summary:
  • This gene, expressed in the pituitary, encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. Many alternate transcriptional splice variants encoding different isoforms have been described, but only two have been characterized to date. [provided by RefSeq
  • Other Designations:
  • GRF receptor,growth hormone-releasing factor receptor,growth hormone-releasing hormone receptor form a,growth hormone-releasing hormone receptor form b,growth hormone-releasing hormone receptor form c
  • RSS
  • YouTube
  • Linkedin
  • Facebook