Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GHRH (Human) Recombinant Protein (P01)

  • Catalog # : H00002691-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GHRH full-length ORF ( NP_066567.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002691-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2691
  • Gene Name:
  • GHRH
  • Gene Alias:
  • GHRF,GRF,MGC119781
  • Gene Description:
  • growth hormone releasing hormone
  • Gene Summary:
  • The protein encoded by this gene belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030915,growth hormone releasing factor,sermorelin,somatocrinin,somatoliberin
  • RSS
  • YouTube
  • Linkedin
  • Facebook