B4GALT1 (Human) Recombinant Protein (Q01)

Catalog # H00002683-Q01

Size

Price

Stock

Quantity

Size:25 ug
Price: USD $ 510.00
Stock:
order now, ship next day
abnova-minus
abnova-plus
Size:10 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
QC Test

  • Specification

    Product Description

    Human B4GALT1 partial ORF ( NP_001488, 44 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.

    Sequence

    GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLEL

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    37.84

    Interspecies Antigen Sequence

    Mouse (75); Rat (76)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — B4GALT1

    Entrez GeneID

    2683

    GeneBank Accession#

    NM_001497

    Protein Accession#

    NP_001488

    Gene Name

    B4GALT1

    Gene Alias

    B4GAL-T1, DKFZp686N19253, GGTB2, GT1, GTB, MGC50983, beta4Gal-T1

    Gene Description

    UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1

    Omim ID

    137060 607091

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase. [provided by RefSeq

    Other Designations

    OTTHUMP00000021196|UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 1, membrane-bound form|glycoprotein-4-beta-galactosyltransferase 2|lactose synthase A protein

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All