GGT1 monoclonal antibody (M01J), clone 1F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GGT1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
GGT1 (NP_005256.2, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (80); Rat (83)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GGT1 monoclonal antibody (M01J), clone 1F9. Western Blot analysis of GGT1 expression in NIH/3T3.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GGT1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — GGT1
Entrez GeneID
2678GeneBank Accession#
NM_005265.2Protein Accession#
NP_005256.2Gene Name
GGT1
Gene Alias
CD224, D22S672, D22S732, GGT, GTG, MGC96892, MGC96904, MGC96963
Gene Description
gamma-glutamyltransferase 1
Omim ID
231950Gene Ontology
HyperlinkGene Summary
The enzyme encoded by this gene catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein, and is present in tissues involved in absorption and secretion. This enzyme is a member of the gamma-glutamyltransferase protein family, of which many members have not yet been fully characterized and some of which may represent pseudogenes. This gene is classified as type I gamma-glutamyltransferase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000028921|OTTHUMP00000159078|gamma-glutamyl transpeptidase|glutamyl transpeptidase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com