Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GFRA1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002674-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GFRA1 partial ORF ( NP_005255.1, 267 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • CQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.97
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002674-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2674
  • Gene Name:
  • GFRA1
  • Gene Alias:
  • GDNFR,GDNFRA,GFR-ALPHA-1,MGC23045,RET1L,RETL1,TRNR1
  • Gene Description:
  • GDNF family receptor alpha 1
  • Gene Summary:
  • Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq
  • Other Designations:
  • GPI-linked anchor protein,Glial cell line-derived neurotrophic factor receptor alpha,OTTHUMP00000020558,OTTHUMP00000020559,PI-linked cell-surface accessory protein,RET ligand 1,TGF-beta related neurotrophic factor receptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook