GFI1 monoclonal antibody (M01), clone 3G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GFI1.
Immunogen
GFI1 (NP_005254, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (78)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GFI1 expression in transfected 293T cell line by GFI1 monoclonal antibody (M01), clone 3G8.
Lane 1: GFI1 transfected lysate(45 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GFI1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GFI1 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GFI1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GFI1
Entrez GeneID
2672GeneBank Accession#
NM_005263Protein Accession#
NP_005254Gene Name
GFI1
Gene Alias
FLJ94509, GFI-1, ZNF163
Gene Description
growth factor independent 1 transcription repressor
Gene Ontology
HyperlinkGene Summary
This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000012582|OTTHUMP00000012583|growth factor independence-1|growth factor independent 1|zinc finger protein 163|zinc finger protein Gfi-1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com