GEM monoclonal antibody (M01), clone 4B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GEM.
Immunogen
GEM (AAH22010, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GEM is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — GEM
Entrez GeneID
2669GeneBank Accession#
BC022010Protein Accession#
AAH22010Gene Name
GEM
Gene Alias
KIR, MGC26294
Gene Description
GTP binding protein overexpressed in skeletal muscle
Omim ID
600164Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
GTP-binding mitogen-induced T-cell protein|GTP-binding protein overexpressed in skeletal muscle|kinase-inducible Ras-like protein
-
Interactome
-
Publication Reference
-
A light-induced small G-protein gem limits the circadian clock phase-shift magnitude by inhibiting voltage-dependent calcium channels.
Masahiro Matsuo, Kazuyuki Seo, Akiyuki Taruno, Yasutaka Mizoro, Yoshiaki Yamaguchi, Masao Doi, Rhyuta Nakao, Hiroshi Kori, Takaya Abe, Harunori Ohmori, Keiko Tominaga, and Hitoshi Okamura.
Cell Reports 2022 May; 39(8):110844.
Application:WB-Ti, Mouse, mouse brain.
-
A light-induced small G-protein gem limits the circadian clock phase-shift magnitude by inhibiting voltage-dependent calcium channels.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com