GCNT2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GCNT2 partial ORF ( NP_663624, 303 a.a. - 402 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (90); Rat (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GCNT2
Entrez GeneID
2651GeneBank Accession#
NM_145649Protein Accession#
NP_663624Gene Name
GCNT2
Gene Alias
CCAT, GCNT2C, GCNT5, IGNT, II, MGC163396, NACGT1, NAGCT1, ULG3, bA360O19.2, bA421M1.1
Gene Description
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Gene Ontology
HyperlinkGene Summary
This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
I beta-1,6-N-acetylglucosaminyltransferase|I-branching beta-1,6-acetylglucosaminyltransferase|Ii blood group|N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase|OTTHUMP00000016015|OTTHUMP00000016018|OTTHUMP00000016021|beta-1,6-N-acetylglucosami
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com