GCNT2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GCNT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GCNT2 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of GCNT2 expression in transfected 293T cell line (H00002651-T02) by GCNT2 MaxPab polyclonal antibody.
Lane 1: GCNT2 transfected lysate(46.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GCNT2 protein.
Immunogen
GCNT2 (NP_663630.2, 1 a.a. ~ 402 a.a) full-length human protein.
Sequence
MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (74)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GCNT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GCNT2 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of GCNT2 expression in transfected 293T cell line (H00002651-T02) by GCNT2 MaxPab polyclonal antibody.
Lane 1: GCNT2 transfected lysate(46.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GCNT2
Entrez GeneID
2651GeneBank Accession#
NM_145655.3Protein Accession#
NP_663630.2Gene Name
GCNT2
Gene Alias
CCAT, GCNT2C, GCNT5, IGNT, II, MGC163396, NACGT1, NAGCT1, ULG3, bA360O19.2, bA421M1.1
Gene Description
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Gene Ontology
HyperlinkGene Summary
This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
I beta-1,6-N-acetylglucosaminyltransferase|I-branching beta-1,6-acetylglucosaminyltransferase|Ii blood group|N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase|OTTHUMP00000016015|OTTHUMP00000016018|OTTHUMP00000016021|beta-1,6-N-acetylglucosami
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com