Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GCN5L2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002648-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GCN5L2 partial ORF ( AAH32743, 738 a.a. - 837 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002648-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2648
  • Gene Name:
  • KAT2A
  • Gene Alias:
  • GCN5,GCN5L2,MGC102791,PCAF-b,hGCN5
  • Gene Description:
  • K(lysine) acetyltransferase 2A
  • Gene Summary:
  • KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM
  • Other Designations:
  • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2,GCN5 general control of amino-acid synthesis 5-like 2,General control of amino acid synthesis, yeast, homolog-like 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook