Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BLOC1S1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002647-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BLOC1S1 full-length ORF ( NP_001478.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002647-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2647
  • Gene Name:
  • BLOC1S1
  • Gene Alias:
  • BLOS1,FLJ39337,FLJ97089,GCN5L1,MGC87455,MICoA,RT14
  • Gene Description:
  • biogenesis of lysosomal organelles complex-1, subunit 1
  • Gene Summary:
  • BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM
  • Other Designations:
  • BLOC subunit 1,BLOC-1 subunit 1,GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1,GCN5 general control of amino-acid synthesis 5-like 1,MTA1-interacting coactivator,biogenesis of lysosome-related organelles complex-1, subunit 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook